PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_1.213
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family G2-like
Protein Properties Length: 366aa    MW: 40571.1 Da    PI: 8.0333
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_1.213genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.82.1e-32201256156
                      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                  k+r++W+peLH+rF++a++qLGGs+ AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  evm.model.supercontig_1.213 201 KQRRCWSPELHRRFLHALQQLGGSHTATPKQIRELMKVDGLTNDEVKSHLQKYRLH 256
                                  79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.776198258IPR017930Myb domain
SuperFamilySSF466895.38E-19198259IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.9E-29198259IPR009057Homeodomain-like
TIGRFAMsTIGR015573.2E-27201256IPR006447Myb domain, plants
PfamPF002491.4E-7203254IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0055062Biological Processphosphate ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MDYATKMQRC HEYVDALEEE RRKIQVFQRE LPLCLELVTQ AIETCKKEIS GTTADYMHVQ  60
SECSEQTMSE VGPPVLEEFI PIKRTSSPDE DEQESHKAST NTNTDKKKSD WLRSVQLWNQ  120
SPDPPPKKDV PKKTTTADQV KINGGAFQPF TKDQPTENCT SNKQPAGKSN NISVPAAATS  180
STDEKTGGKR EEKEGQQTQR KQRRCWSPEL HRRFLHALQQ LGGSHTATPK QIRELMKVDG  240
LTNDEVKSHL QKYRLHTRRP TQNVQTNGNS QAPQFVVVGG IWVPPQEYAT ITAATAPASG  300
EGCNGIYAPV PVAALPTPAK ERPQQTQSHR MQSEERGCSH SEGRVHSSSP STSSSTHTTT  360
ASPVF*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00218DAPTransfer from AT1G68670Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003631224.11e-153PREDICTED: probable transcription factor GLK2
TrEMBLD7T9871e-149D7T987_VITVI; Putative uncharacterized protein
STRINGVIT_01s0011g03110.t011e-149(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34912863
Representative plantOGRP54151221
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.12e-97G2-like family protein